Anti-FOXO3A Antibody

Category: Antibodies
Catalog
A283283
( Ships in 5-10 business days )

Questions? Contact us

Call (800) 832-2611

arp-guarantee
- +
$0.00
More Information
Product Name Anti-FOXO3A Antibody
Description Rabbit polyclonal antibody to FOXO3A.
Host Rabbit
Clonality Polyclonal
Conjugate Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 600-673 of human FOXO3A conjugated to Keyhole Limpet Haemocyanin.
Isotype IgG
Target FOXO3A
Amino Acid Sequence PVMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG
Protein Length 74
Specificity This antibody recognises human forkhead box O3A (FOXO3A), also known as FKHLR1 and FOXO3, a ~95 kDa member of the forkhead family of transcription factors.FOXO3A is ubiquitously expressed and is an important regulator of apoptosis and the cell cycle. FOXO3A triggers apoptosis by inducing the expression of genes necessary for cell death.
Reactivity Gallus, Monkey, Xenopus, Bovine, Canine, Human, Mouse, Rat
Applications IHC-P, WB
Working Dilutions IHC-P: 10 µg/ml, WB: 2 - 4 µg/ml, This product does not require protein digestion pre-treatment of paraffin sections. This product does not require antigen retrieval using heat treatment prior to staining of paraffin sections.
Form Liquid
Diluent Buffer Supplied in Phosphate Buffered Saline with 0.5% BSA and <0.1% Sodium Azide.
Concentration 500 µg/ml
Storage Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.
Supplier Antibodies.com

All Research Products are sold for laboratory RESEARCH USE ONLY and ARE NOT TO BE USED FOR HUMAN OR ANIMAL THERAPEUTIC OR DIAGNOSTIC APPLICATIONS. The information presented is believed to be accurate; however, said information and products are offered without warranty or guarantee since the ultimate conditions of use and the variability of the materials treated are beyond our control. Nothing disclosed herein is to be construed as a recommendation to use our products in violation of any patents. ARP American Research Products, Inc. does not submit its products for regulatory review by any government body or other organization, and we do not validate them for clinical, therapeutic or diagnostic use, or for safety and effectiveness. You are solely responsible for making sure that the way you use the products complies with applicable laws, regulations and governmental policies and for obtaining all necessary approvals, intellectual property rights, licenses and permissions that you may need related to your use. Under no circumstances shall ARP American Research Products, Inc. be liable for damages, whether consequential, compensatory, incidental or special, strict liability or negligence, breach of warranty or any other theory arising out of the use of the products available from ARP American Research Products, Inc. Nothing contained herein warrants that the use of the products will not infringe on the claims of any patents covering the product itself or the use thereof in combination with other products or in the operation of any process. ARP American Research Products, Inc. disclaims any and all representations or warranties of any kind whatsoever, express or implied, including without limitation any implied warranties of merchantability or fitness for a particular purpose, of non-infringement, or regarding results obtained through the use of any product, whether arising from a statute or otherwise in law or from a course of performance, dealing or usage of trade.